Lineage for d3ubpb_ (3ubp B:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 63938Fold b.85: beta-clip [51268] (6 superfamilies)
  4. 63988Superfamily b.85.3: Urease, beta-subunit [51278] (1 family) (S)
  5. 63989Family b.85.3.1: Urease, beta-subunit [51279] (1 protein)
  6. 63990Protein Urease, beta-subunit [51280] (2 species)
  7. 63991Species Bacillus pasteurii [TaxId:1474] [51282] (5 PDB entries)
  8. 63996Domain d3ubpb_: 3ubp B: [28348]
    Other proteins in same PDB: d3ubpa_, d3ubpc1, d3ubpc2

Details for d3ubpb_

PDB Entry: 3ubp (more details), 2 Å

PDB Description: diamidophosphate inhibited bacillus pasteurii urease

SCOP Domain Sequences for d3ubpb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ubpb_ b.85.3.1 (B:) Urease, beta-subunit {Bacillus pasteurii}
nyivpgeyrvaegeieinagrekttirvsntgdrpiqvgshihfvevnkellfdraegig
rrlnipsgtaarfepgeemeveltelggnrevfgisdltngsvdnkelilqrakelgykg
ve

SCOP Domain Coordinates for d3ubpb_:

Click to download the PDB-style file with coordinates for d3ubpb_.
(The format of our PDB-style files is described here.)

Timeline for d3ubpb_: