Lineage for d3ubpc2 (3ubp C:132-434,C:484-570)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 64292Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies)
  4. 65203Superfamily c.1.9: Metallo-dependent hydrolases [51556] (4 families) (S)
  5. 65221Family c.1.9.2: alpha-subunit of urease, catalytic domain [51560] (1 protein)
  6. 65222Protein alpha-subunit of urease, catalytic domain [51561] (2 species)
  7. 65223Species Bacillus pasteurii [TaxId:1474] [51563] (5 PDB entries)
  8. 65228Domain d3ubpc2: 3ubp C:132-434,C:484-570 [29056]
    Other proteins in same PDB: d3ubpa_, d3ubpb_, d3ubpc1

Details for d3ubpc2

PDB Entry: 3ubp (more details), 2 Å

PDB Description: diamidophosphate inhibited bacillus pasteurii urease

SCOP Domain Sequences for d3ubpc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ubpc2 c.1.9.2 (C:132-434,C:484-570) alpha-subunit of urease, catalytic domain {Bacillus pasteurii}
ggidthvhfinpdqvdvalangittlfgggtgpaegskattvtpgpwniekmlksteglp
invgilgkghgssiapimeqidagaaglkihedwgatpasidrsltvadeadvqvaihsd
tlneagfledtlraingrvihsfhvegaggghapdimamaghpnvlpsstnptrpftvnt
idehldmlmvchhlkqnipedvafadsrirpetiaaedilhdlgiismmstdalamgrag
emvlrtwqtadkmkkqrgplaeekngsdnfrlkryvskytinpaiaqgiahevgsieegk
fadXgdlihdtnitfmskssiqqgvpaklglkrrigtvkncrnigkkdmkwndvttdidi
npetyevkvdgevltcepvkelpmaqryflf

SCOP Domain Coordinates for d3ubpc2:

Click to download the PDB-style file with coordinates for d3ubpc2.
(The format of our PDB-style files is described here.)

Timeline for d3ubpc2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3ubpc1