Lineage for d6haea1 (6hae A:1-242)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (318 species)
    not a true protein
  7. 2847602Species Methanococcus aeolicus [TaxId:419665] [373338] (3 PDB entries)
  8. 2847604Domain d6haea1: 6hae A:1-242 [373344]
    Other proteins in same PDB: d6haea2, d6haek2
    automated match to d4jjfa1
    complexed with 2pe, cl, e4m, fe9, gol, k, na, scn

Details for d6haea1

PDB Entry: 6hae (more details), 1.85 Å

PDB Description: crystal structure of [fe]-hydrogenase (hmd) from methanococcus aeolicus in complex with fegp cofactor and methenyl- tetrahydromethanopterin (close form b)
PDB Compounds: (A:) 5,10-methenyltetrahydromethanopterin hydrogenase

SCOPe Domain Sequences for d6haea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6haea1 c.2.1.0 (A:1-242) automated matches {Methanococcus aeolicus [TaxId: 419665]}
mkvailgagcyrshaacgitnfsraaevankvgipeitmthstitmgaellhlvdeidev
vvsdpcfaeepgliiidefdckevmeahlagkaedvmpairdavkakakdspkppkgcih
fvnpekvglkvtsddreaiegadivitwlpkggsqpaiiekfvdaikegaivthactipt
pkfakifkdlgredlnivsfhpgcvpemkgqvylsegyaseeaveklykiakisrgtafk
mp

SCOPe Domain Coordinates for d6haea1:

Click to download the PDB-style file with coordinates for d6haea1.
(The format of our PDB-style files is described here.)

Timeline for d6haea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6haea2