Lineage for d6haea2 (6hae A:243-342)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2721323Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 2721324Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 2721533Family a.100.1.0: automated matches [227147] (1 protein)
    not a true family
  6. 2721534Protein automated matches [226851] (46 species)
    not a true protein
  7. 2721825Species Methanococcus aeolicus [TaxId:419665] [373340] (3 PDB entries)
  8. 2721827Domain d6haea2: 6hae A:243-342 [373345]
    Other proteins in same PDB: d6haea1, d6haek1
    automated match to d4jjfa2
    complexed with 2pe, cl, e4m, fe9, gol, k, na, scn

Details for d6haea2

PDB Entry: 6hae (more details), 1.85 Å

PDB Description: crystal structure of [fe]-hydrogenase (hmd) from methanococcus aeolicus in complex with fegp cofactor and methenyl- tetrahydromethanopterin (close form b)
PDB Compounds: (A:) 5,10-methenyltetrahydromethanopterin hydrogenase

SCOPe Domain Sequences for d6haea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6haea2 a.100.1.0 (A:243-342) automated matches {Methanococcus aeolicus [TaxId: 419665]}
anlispvcdmgsavtapvyaailsyrdavtnilgapadfaqmmadeaitqmlelmrnegi
qnmenklnpgaltgtadsmcfgplsellpaslkvleehkk

SCOPe Domain Coordinates for d6haea2:

Click to download the PDB-style file with coordinates for d6haea2.
(The format of our PDB-style files is described here.)

Timeline for d6haea2:

View in 3D
Domains from same chain:
(mouse over for more information)
d6haea1