Lineage for d1fo7a_ (1fo7 A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2535859Fold d.6: Prion-like [54097] (1 superfamily)
    beta-alpha-beta-alpha(2); antiparallel beta-ribbon
  4. 2535860Superfamily d.6.1: Prion-like [54098] (1 family) (S)
  5. 2535861Family d.6.1.1: Prion-like [54099] (3 proteins)
  6. 2535862Protein Prion protein domain [54100] (14 species)
  7. 2535880Species Human (Homo sapiens) [TaxId:9606] [54103] (18 PDB entries)
  8. 2535894Domain d1fo7a_: 1fo7 A: [37314]
    mutant

Details for d1fo7a_

PDB Entry: 1fo7 (more details)

PDB Description: human prion protein mutant e200k fragment 90-231
PDB Compounds: (A:) prion protein

SCOPe Domain Sequences for d1fo7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fo7a_ d.6.1.1 (A:) Prion protein domain {Human (Homo sapiens) [TaxId: 9606]}
lggymlgsamsrpiihfgsdyedryyrenmhrypnqvyyrpmdeysnqnnfvhdcvniti
kqhtvttttkgenftktdvkmmervveqmcitqyeresqayyqrgss

SCOPe Domain Coordinates for d1fo7a_:

Click to download the PDB-style file with coordinates for d1fo7a_.
(The format of our PDB-style files is described here.)

Timeline for d1fo7a_: