![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like |
![]() | Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) ![]() binds cofactor molecules in the opposite direction than classical Rossmann fold |
![]() | Family c.31.1.0: automated matches [191352] (1 protein) not a true family |
![]() | Protein automated matches [190312] (14 species) not a true protein |
![]() | Species Lactobacillus plantarum [TaxId:1590] [373122] (1 PDB entry) |
![]() | Domain d6hafa2: 6haf A:183-365 [373123] Other proteins in same PDB: d6hafa1, d6hafa3, d6hafb1, d6hafb3 automated match to d2ez9a1 complexed with fad, gol, k, mg, po4, tdp |
PDB Entry: 6haf (more details), 1.3 Å
SCOPe Domain Sequences for d6hafa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6hafa2 c.31.1.0 (A:183-365) automated matches {Lactobacillus plantarum [TaxId: 1590]} yasansyqtpllpepdvqavtrltqtllaaerpliyygigarkagkeleqlsktlkiplm stypakgivadrypaylgsanrvaqkpanealaqadvvlfvgnnypfaevskafkntryf lqididpaklgkrhktdiavladaqktlaailaqvserestpwwqanlanvknwraylas led
Timeline for d6hafa2: