SCOPe 2.07: Domain d6hafa3: 6haf A:366-593

Lineage for d6hafa3 (6haf A:366-593)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465

4. Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families)
   there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
   two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules

5. Family c.36.1.0: automated matches [227300] (1 protein)
   not a true family

6. Protein automated matches [227126] (21 species)
   not a true protein

7. Species Lactobacillus plantarum [TaxId:1590] [254973] (7 PDB entries)

8. Domain d6hafa3: 6haf A:366-593 [373124]
   Other proteins in same PDB: d6hafa2, d6hafb2
   automated match to d1powa3
   complexed with fad, gol, k, mg, po4, tdp

Details for d6hafa3

PDB Entry: 6haf, 1.3 Å

PDB Description: pyruvate oxidase variant e59q from l. plantarum in complex with phosphate

PDB Compounds: (A:) Pyruvate oxidase

SCOPe Domain Sequences for d6hafa3:

Sequence; same for both SEQRES and ATOM records:

>d6hafa3 c.36.1.0 (A:366-593) automated matches {Lactobacillus plantarum [TaxId: 1590]}
kqegplqayqvlravnkiaepdaiysidvgdinlnanrhlkltpsnrhitsnlfatmgvg
ipgaiaaklnyperqvfnlagdggasmtmqdlatqvqyhlpvinvvftncqygfikdeqe
dtnqndfigvefndidfskiadgvhmqafrvnkieqlpdvfeqakaiaqhepvlidavit
gdrplpaeklrldsamssaadieafkqryeaqdlqplstylkqfgldd

Timeline for d6hafa3:

• d6hafa3 is new in SCOPe 2.07-stable
  
• d6hafa3 appears in the current release, SCOPe 2.08