| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) ![]() there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
| Family c.36.1.0: automated matches [227300] (1 protein) not a true family |
| Protein automated matches [227126] (21 species) not a true protein |
| Species Lactobacillus plantarum [TaxId:1590] [254973] (7 PDB entries) |
| Domain d6hafa3: 6haf A:366-593 [373124] Other proteins in same PDB: d6hafa2, d6hafb2 automated match to d1powa3 complexed with fad, gol, k, mg, po4, tdp |
PDB Entry: 6haf (more details), 1.3 Å
SCOPe Domain Sequences for d6hafa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d6hafa3 c.36.1.0 (A:366-593) automated matches {Lactobacillus plantarum [TaxId: 1590]}
kqegplqayqvlravnkiaepdaiysidvgdinlnanrhlkltpsnrhitsnlfatmgvg
ipgaiaaklnyperqvfnlagdggasmtmqdlatqvqyhlpvinvvftncqygfikdeqe
dtnqndfigvefndidfskiadgvhmqafrvnkieqlpdvfeqakaiaqhepvlidavit
gdrplpaeklrldsamssaadieafkqryeaqdlqplstylkqfgldd
Timeline for d6hafa3: