SCOPe 2.08: Domain d6agkf1: 6agk F:1-76

Lineage for d6agkf1 (6agk F:1-76)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
   3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
   possible rudiment form of Rossmann-fold domain

4. Superfamily c.30.1: PreATP-grasp domain [52440] (10 families)
   precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function

5. Family c.30.1.9: Tubulin tyrosine ligase (TTL) N-terminal domain-like [310625] (1 protein)

6. Protein Tubulin tyrosine ligase (TTL) N-terminal domain [310727] (2 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [311384] (188 PDB entries)

8. Domain d6agkf1: 6agk F:1-76 [373083]
   Other proteins in same PDB: d6agka1, d6agka2, d6agkb1, d6agkb2, d6agkc1, d6agkc2, d6agkd1, d6agkd2, d6agke_, d6agkf2
   automated match to d3tiia1
   complexed with 9wr, acp, ca, gdp, gtp, mes, mg

Details for d6agkf1

PDB Entry: 6agk, 2.8 Å

PDB Description: the structure of ch-ii-77-tubulin complex

PDB Compounds: (F:) tubulin tyrosine ligase

SCOPe Domain Sequences for d6agkf1:

Sequence; same for both SEQRES and ATOM records:

>d6agkf1 c.30.1.9 (F:1-76) Tubulin tyrosine ligase (TTL) N-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}
mytfvvrdenssvyaevsrlllatgqwkrlrkdnprfnlmlgernrlpfgrlghepglvq
lvnyyrgadklcrkas

Timeline for d6agkf1:

• d6agkf1 first appeared in SCOPe 2.07