SCOPe 2.08: Domain d6agkc1: 6agk C:1-245

Lineage for d6agkc1 (6agk C:1-245)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families)
   automatically mapped to Pfam PF00091

5. Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)

6. Protein automated matches [226837] (9 species)
   not a true protein

7. Species Pig (Sus scrofa) [TaxId:9823] [278808] (66 PDB entries)

8. Domain d6agkc1: 6agk C:1-245 [373140]
   Other proteins in same PDB: d6agka2, d6agkb2, d6agkc2, d6agkd2, d6agke_, d6agkf1, d6agkf2
   automated match to d5fnva1
   complexed with 9wr, acp, ca, gdp, gtp, mes, mg

Details for d6agkc1

PDB Entry: 6agk, 2.8 Å

PDB Description: the structure of ch-ii-77-tubulin complex

PDB Compounds: (C:) Tubulin alpha-1B chain

SCOPe Domain Sequences for d6agkc1:

Sequence; same for both SEQRES and ATOM records:

>d6agkc1 c.32.1.1 (C:1-245) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
mrecisihvgqagvqignacwelyclehgiqpdgqmpsdktigggddsfntffsetgagk
hvpravfvdleptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvld
rirkladqctglqgflvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvsta
vvepynsiltthttlehsdcafmvdneaiydicrrnldierptytnlnrlisqivssita
slrfd

Timeline for d6agkc1:

• d6agkc1 first appeared in SCOPe 2.07