SCOPe 2.07: Domain d6ihjd_: 6ihj D:

Lineage for d6ihjd_ (6ihj D:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (31 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.0: automated matches [191337] (1 protein)
   not a true family

6. Protein automated matches [190205] (33 species)
   not a true protein

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [195496] (3 PDB entries)

8. Domain d6ihjd_: 6ihj D: [372914]
   automated match to d1jkga_

Details for d6ihjd_

PDB Entry: 6ihj, 2.7 Å

PDB Description: crystal structure of drosophila nxf1 ntf2 domain in complex with nxt1/p15

PDB Compounds: (D:) NTF2-related export protein

SCOPe Domain Sequences for d6ihjd_:

Sequence, based on SEQRES records:

>d6ihjd_ d.17.4.0 (D:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
dsdlkakvescartadtftrlyyasvdnrrqqigrlyldnatlswngngaigrqmiesyf
qelpssnhqlntldaqpivdqavsnqlaylimasgsvkfadqqlrkfqqtfivtaendkw
kvvsdcyrmqev

Sequence, based on observed residues (ATOM records):

>d6ihjd_ d.17.4.0 (D:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
dsdlkakvescartadtftrlyyasvdnrrqlyldnatlswngngaigrqmiesyfqelp
ssnhqlntldaqpivdqlaylimasgsvkfadqqlrkfqqtfivtandkwkvvsdcyrmq
ev

Timeline for d6ihjd_:

• d6ihjd_ is new in SCOPe 2.07-stable
  
• d6ihjd_ appears in the current release, SCOPe 2.08