SCOPe 2.03: Domain d11bgb_: 11bg B:

Lineage for d11bgb_ (11bg B:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.5: RNase A-like [54075] (1 superfamily)
   contains long curved beta-sheet and 3 helices

4. Superfamily d.5.1: RNase A-like [54076] (2 families)
   can be classified as disulfide-rich

5. Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)

6. Protein Seminal ribonucleasease [54086] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [54087] (16 PDB entries)
   Uniprot P00669 27-150

8. Domain d11bgb_: 11bg B: [37283]
   complexed with so4, u2g

Details for d11bgb_

PDB Entry: 11bg, 1.9 Å

PDB Description: a potential allosteric subsite generated by domain swapping in bovine seminal ribonuclease

PDB Compounds: (B:) protein (bovine seminal ribonuclease)

SCOPe Domain Sequences for d11bgb_:

Sequence; same for both SEQRES and ATOM records:

>d11bgb_ d.5.1.1 (B:) Seminal ribonucleasease {Cow (Bos taurus) [TaxId: 9913]}
kesaaakferqhmdsgnspssssnycnlmmccrkmtqgkckpvntfvhesladvkavcsq
kkvtckngqtncyqskstmritdcretgsskypncaykttqvekhiivacggkpsvpvhf
dasv

Timeline for d11bgb_:

• d11bgb_ first appeared (with stable ids) in SCOP 1.55
  
• d11bgb_ appears in SCOPe 2.02
  
• d11bgb_ appears in SCOPe 2.04
  
• d11bgb_ appears in the current release, SCOPe 2.08