Lineage for d11bgb_ (11bg B:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) Fold d.5: RNase A-like [54075] (1 superfamily) Superfamily d.5.1: RNase A-like [54076] (1 family) 
Family d.5.1.1: Ribonuclease A-like [54077] (8 proteins) 
Protein Seminal ribonucleasease [54086] (1 species) Species Cow (Bos taurus) [TaxId:9913] [54087] (3 PDB entries) 
Domain d11bgb_: 11bg B: [37283]
Details for d11bgb_
PDB Entry: 11bg (more details), 1.9 Å
PDB Description: a potential allosteric subsite generated by domain swapping in bovine seminal ribonuclease
SCOP Domain Sequences for d11bgb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d11bgb_ d.5.1.1 (B:) Seminal ribonucleasease {Cow (Bos taurus)}
kesaaakferqhmdsgnspssssnycnlmmccrkmtqgkckpvntfvhesladvkavcsq
kkvtckngqtncyqskstmritdcretgsskypncaykttqvekhiivacggkpsvpvhf
dasv
SCOP Domain Coordinates for d11bgb_:
Click to download the PDB-style file with coordinates for d11bgb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d11bgb_:
- d11bgb_ appears in SCOP 1.57
- d11bgb_ appears in the current release, SCOPe 2.08
View in 3D
