Lineage for d6p29b_ (6p29 B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2549433Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 2549434Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) (S)
  5. 2549945Family d.32.1.0: automated matches [191344] (1 protein)
    not a true family
  6. 2549946Protein automated matches [190239] (26 species)
    not a true protein
  7. 2550044Species Pseudoalteromonas luteoviolacea [TaxId:43657] [372665] (1 PDB entry)
  8. 2550046Domain d6p29b_: 6p29 B: [372676]
    Other proteins in same PDB: d6p29a2
    automated match to d2rk9b_
    complexed with nq7, pge

Details for d6p29b_

PDB Entry: 6p29 (more details), 1.5 Å

PDB Description: n-demethylindolmycin synthase (plun2) in complex with n- demethylindolmycin
PDB Compounds: (B:) N-demethylindolmycin synthase (PluN2)

SCOPe Domain Sequences for d6p29b_:

Sequence, based on SEQRES records: (download)

>d6p29b_ d.32.1.0 (B:) automated matches {Pseudoalteromonas luteoviolacea [TaxId: 43657]}
mefnntipelvcrdidsslsfytqklgfkvlfereeqgffflykndiqlmlqqlgetawm
shsndtpfgngmniafkveslddldcstpsedifletetieyrvldgvasvnqvifrdpd
gylirfveqv

Sequence, based on observed residues (ATOM records): (download)

>d6p29b_ d.32.1.0 (B:) automated matches {Pseudoalteromonas luteoviolacea [TaxId: 43657]}
mefnntipelvcrdidsslsfytqklgfkvlfereeqgffflykndiqlmlqqlgetawm
shsndtpfgngmniafkveslddldcstsedifletetieyrvldgvasvnqvifrdpdg
ylirfveqv

SCOPe Domain Coordinates for d6p29b_:

Click to download the PDB-style file with coordinates for d6p29b_.
(The format of our PDB-style files is described here.)

Timeline for d6p29b_: