SCOPe 2.07: Domain d6p29a1: 6p29 A:1-132

Lineage for d6p29a1 (6p29 A:1-132)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
   beta-alpha-beta(3); 2 layers: alpha/beta

4. Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families)

5. Family d.32.1.0: automated matches [191344] (1 protein)
   not a true family

6. Protein automated matches [190239] (26 species)
   not a true protein

7. Species Pseudoalteromonas luteoviolacea [TaxId:43657] [372665] (1 PDB entry)

8. Domain d6p29a1: 6p29 A:1-132 [372666]
   Other proteins in same PDB: d6p29a2
   automated match to d2rk9b_
   complexed with nq7, pge

Details for d6p29a1

PDB Entry: 6p29, 1.5 Å

PDB Description: n-demethylindolmycin synthase (plun2) in complex with n- demethylindolmycin

PDB Compounds: (A:) N-demethylindolmycin synthase (PluN2)

SCOPe Domain Sequences for d6p29a1:

Sequence; same for both SEQRES and ATOM records:

>d6p29a1 d.32.1.0 (A:1-132) automated matches {Pseudoalteromonas luteoviolacea [TaxId: 43657]}
mefnntipelvcrdidsslsfytqklgfkvlfereeqgffflykndiqlmlqqlgetawm
shsndtpfgngmniafkveslddldcstpsedifletetieyrvldgvasvnqvifrdpd
gylirfveqvnq

Timeline for d6p29a1:

• d6p29a1 is new in SCOPe 2.07-stable
  
• d6p29a1 appears in the current release, SCOPe 2.08