Lineage for d6oell2 (6oel L:128-233)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2758397Domain d6oell2: 6oel L:128-233 [372630]
    Other proteins in same PDB: d6oela_, d6oelb1, d6oelb2, d6oelb3, d6oelc1, d6oelh2
    automated match to d1dqdl2
    complexed with nag, no3

Details for d6oell2

PDB Entry: 6oel (more details), 3.1 Å

PDB Description: engineered fab bound to il-4 receptor
PDB Compounds: (L:) engineered Fab light chain

SCOPe Domain Sequences for d6oell2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6oell2 b.1.1.0 (L:128-233) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdsqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

SCOPe Domain Coordinates for d6oell2:

Click to download the PDB-style file with coordinates for d6oell2.
(The format of our PDB-style files is described here.)

Timeline for d6oell2: