| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (2 families) ![]() |
| Family b.1.2.1: Fibronectin type III [49266] (45 proteins) Pfam PF00041 |
| Protein automated matches [190888] (2 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [188282] (33 PDB entries) |
| Domain d6oelb2: 6oel B:97-199 [372660] Other proteins in same PDB: d6oela_, d6oelb3, d6oelc1, d6oelh1, d6oelh2, d6oell1, d6oell2 automated match to d3bpnb2 complexed with nag, no3 |
PDB Entry: 6oel (more details), 3.1 Å
SCOPe Domain Sequences for d6oelb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6oelb2 b.1.2.1 (B:97-199) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kprapgnltvhtnvsdtllltwsnpyppdnylynhltyavniwsendpadfriynvtyle
pslriaastlksgisyrarvrawaqcynttwsewspstkwhns
Timeline for d6oelb2: