Lineage for d6qk9f1 (6qk9 F:1-71)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2931198Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2931514Protein Ubiquitin [54238] (9 species)
  7. 2931628Species Human (Homo sapiens) [TaxId:9606] [54239] (312 PDB entries)
    Uniprot P62988
    identical sequence in many other species
  8. 2931949Domain d6qk9f1: 6qk9 F:1-71 [372075]
    Other proteins in same PDB: d6qk9a2, d6qk9b2, d6qk9c2, d6qk9e2, d6qk9f2, d6qk9h2, d6qk9i2, d6qk9j2, d6qk9k2, d6qk9l2
    automated match to d5ibkc_

Details for d6qk9f1

PDB Entry: 6qk9 (more details), 2.23 Å

PDB Description: a dimeric ubiquitin formed by a single amino acid substitution
PDB Compounds: (F:) Polyubiquitin-B

SCOPe Domain Sequences for d6qk9f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6qk9f1 d.15.1.1 (F:1-71) Ubiquitin {Human (Homo sapiens) [TaxId: 9606]}
mqifvktltvktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
iqkestlhlvl

SCOPe Domain Coordinates for d6qk9f1:

Click to download the PDB-style file with coordinates for d6qk9f1.
(The format of our PDB-style files is described here.)

Timeline for d6qk9f1: