SCOPe 2.08: Domain d6ptac_: 6pta C:

Lineage for d6ptac_ (6pta C:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (81 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein automated matches [190047] (37 species)
   not a true protein

7. Species Candida albicans [TaxId:237561] [329047] (2 PDB entries)

8. Domain d6ptac_: 6pta C: [372031]
   automated match to d3lrpa_
   complexed with gdp

Details for d6ptac_

PDB Entry: 6pta, 2.5 Å

PDB Description: crystal structure of the arf family small gtpase arf1 from candida albicans in complex with gdp

PDB Compounds: (C:) ADP-ribosylation factor

SCOPe Domain Sequences for d6ptac_:

Sequence, based on SEQRES records:

>d6ptac_ c.37.1.8 (C:) automated matches {Candida albicans [TaxId: 237561]}
lfasllgrremrilmvgldaagkttilyklklgeivttiptigfnvetveyknisftvwd
vggqdkirplwryyfqntqgiifvvdsndrdrineareelqsmlnedelkdavllvlank
qdlpnamnaaeitekmglhsirnrpwfiqatcattgdglyeglewlsnqvg

Sequence, based on observed residues (ATOM records):

>d6ptac_ c.37.1.8 (C:) automated matches {Candida albicans [TaxId: 237561]}
lfasllgrmrilmvgldaagkttilyklklgeivttiptigfnvetveyknisftvwdvg
rplwryyfqntqgiifvvdsndrdrineareelqsmlnedelkdavllvlankqdlpnam
naaeitekmglhsirnrpwfiqatcattgdglyeglewlsnqvg

Timeline for d6ptac_:

• d6ptac_ first appeared in SCOPe 2.07