Lineage for d5zzja1 (5zzj A:39-241)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2335133Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2335598Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families) (S)
  5. 2335934Family a.102.4.0: automated matches [227201] (1 protein)
    not a true family
  6. 2335935Protein automated matches [226931] (11 species)
    not a true protein
  7. 2335970Species Santalum album [TaxId:35974] [367258] (11 PDB entries)
  8. 2335984Domain d5zzja1: 5zzj A:39-241 [371772]
    Other proteins in same PDB: d5zzja2, d5zzjb2, d5zzjc2, d5zzjd2
    automated match to d2onha1

Details for d5zzja1

PDB Entry: 5zzj (more details), 2.6 Å

PDB Description: crystal structure of a enzyme from santalum album
PDB Compounds: (A:) Santalene synthase

SCOPe Domain Sequences for d5zzja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zzja1 a.102.4.0 (A:39-241) automated matches {Santalum album [TaxId: 35974]}
psiwnydflqslathhniveerhlklaeklkgqvkfmfgapmeplaklelvdvvqrlgln
hlfeteikealfsiykdgsngwwfghlhatslrfrllrqcglfipqdvfktfqnktgefd
mklcdnvkgllslyeasylgwkgenildeakafttkclksawenisekwlakrvkhalal
plhwrvpriearwfieayeqean

SCOPe Domain Coordinates for d5zzja1:

Click to download the PDB-style file with coordinates for d5zzja1.
(The format of our PDB-style files is described here.)

Timeline for d5zzja1: