SCOPe 2.07: Domain d5zzjd1: 5zzj D:39-241

Lineage for d5zzjd1 (5zzj D:39-241)

Root: SCOPe 2.07
Class a: All alpha proteins [46456] (289 folds)

Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies

Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families)
Family a.102.4.0: automated matches [227201] (1 protein)
not a true family
Protein automated matches [226931] (11 species)
not a true protein
Species Santalum album [TaxId:35974] [367258] (11 PDB entries)
Domain d5zzjd1: 5zzj D:39-241 [371761]
Other proteins in same PDB: d5zzja2, d5zzjb2, d5zzjc2, d5zzjd2
automated match to d2onha1

Details for d5zzjd1

PDB Entry: 5zzj (more details), 2.6 Å

PDB Description: crystal structure of a enzyme from santalum album

PDB Compounds: (D:) Santalene synthase

SCOPe Domain Sequences for d5zzjd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zzjd1 a.102.4.0 (D:39-241) automated matches {Santalum album [TaxId: 35974]}
psiwnydflqslathhniveerhlklaeklkgqvkfmfgapmeplaklelvdvvqrlgln
hlfeteikealfsiykdgsngwwfghlhatslrfrllrqcglfipqdvfktfqnktgefd
mklcdnvkgllslyeasylgwkgenildeakafttkclksawenisekwlakrvkhalal
plhwrvpriearwfieayeqean

SCOPe Domain Coordinates for d5zzjd1:

Click to download the PDB-style file with coordinates for d5zzjd1.
(The format of our PDB-style files is described here.)

Timeline for d5zzjd1: