Class a: All alpha proteins [46456] (289 folds) |
Fold a.69: Left-handed superhelix [47916] (4 superfamilies) core: 4-5 helices; bundle; left-handed superhelix |
Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (3 families) |
Family a.69.1.0: automated matches [254233] (1 protein) not a true family |
Protein automated matches [254528] (17 species) not a true protein |
Species Polytomella sp. [TaxId:37502] [371492] (10 PDB entries) |
Domain d6rdet3: 6rde T:436-562 [371527] Other proteins in same PDB: d6rdes_, d6rdet1, d6rdet2 automated match to d5cdfa3 complexed with adp, atp, mg |
PDB Entry: 6rde (more details), 2.9 Å
SCOPe Domain Sequences for d6rdet3:
Sequence; same for both SEQRES and ATOM records: (download)
>d6rdet3 a.69.1.0 (T:436-562) automated matches {Polytomella sp. [TaxId: 37502]} fpgmkqvagtlklelaqyrevaafaqfgsdldaatqyvlergarltemlkqkqfapipie rqtvavyaatkgfldkvrvqdivaaeeavisqvnpavfkilkangkitpaldahlkaelr kvklpga
Timeline for d6rdet3: