Lineage for d6rdet1 (6rde T:80-150)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2408137Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (4 superfamilies)
    barrel, closed; n=6, S=8; greek-key
    Many cradle-loop superfamilies may be homologous, according to PubMed 18457946
  4. 2408138Superfamily b.49.1: N-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [50615] (3 families) (S)
    automatically mapped to Pfam PF02874
  5. 2408357Family b.49.1.0: automated matches [254232] (1 protein)
    not a true family
  6. 2408358Protein automated matches [254527] (17 species)
    not a true protein
  7. 2408481Species Polytomella sp. [TaxId:37502] [371488] (10 PDB entries)
  8. 2408487Domain d6rdet1: 6rde T:80-150 [371525]
    Other proteins in same PDB: d6rdes_, d6rdet2, d6rdet3
    automated match to d5cdfa1
    complexed with adp, atp, mg

Details for d6rdet1

PDB Entry: 6rde (more details), 2.9 Å

PDB Description: cryoem structure of polytomella f-atp synthase, primary rotary state 2, focussed refinement of f1 head and rotor
PDB Compounds: (T:) ATP synthase subunit alpha

SCOPe Domain Sequences for d6rdet1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6rdet1 b.49.1.0 (T:80-150) automated matches {Polytomella sp. [TaxId: 37502]}
pvihlgrvlsvgdgiarvyglksvqagelvcfdsgvkgmalnlqadhvgvvvfgndsvih
qgdlvyrtgqi

SCOPe Domain Coordinates for d6rdet1:

Click to download the PDB-style file with coordinates for d6rdet1.
(The format of our PDB-style files is described here.)

Timeline for d6rdet1:

View in 3D
Domains from other chains:
(mouse over for more information)
d6rdes_