Class b: All beta proteins [48724] (178 folds) |
Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (4 superfamilies) barrel, closed; n=6, S=8; greek-key Many cradle-loop superfamilies may be homologous, according to PubMed 18457946 |
Superfamily b.49.1: N-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [50615] (3 families) automatically mapped to Pfam PF02874 |
Family b.49.1.0: automated matches [254232] (1 protein) not a true family |
Protein automated matches [254527] (17 species) not a true protein |
Species Polytomella sp. [TaxId:37502] [371488] (10 PDB entries) |
Domain d6rdet1: 6rde T:80-150 [371525] Other proteins in same PDB: d6rdes_, d6rdet2, d6rdet3 automated match to d5cdfa1 complexed with adp, atp, mg |
PDB Entry: 6rde (more details), 2.9 Å
SCOPe Domain Sequences for d6rdet1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6rdet1 b.49.1.0 (T:80-150) automated matches {Polytomella sp. [TaxId: 37502]} pvihlgrvlsvgdgiarvyglksvqagelvcfdsgvkgmalnlqadhvgvvvfgndsvih qgdlvyrtgqi
Timeline for d6rdet1: