Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (24 families) the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
Family d.3.1.2: FMDV leader protease [54037] (2 proteins) automatically mapped to Pfam PF05408 |
Protein FMDV leader protease [54038] (1 species) |
Species Foot-and-mouth disease virus [TaxId:12110] [54039] (3 PDB entries) |
Domain d1qole_: 1qol E: [37101] complexed with cl, edo |
PDB Entry: 1qol (more details), 3 Å
SCOPe Domain Sequences for d1qole_:
Sequence, based on SEQRES records: (download)
>d1qole_ d.3.1.2 (E:) FMDV leader protease {Foot-and-mouth disease virus [TaxId: 12110]} meltlyngekktfysrpnnhdnawlnailqlfryveepffdwvysspenltleaikqled ltglelheggppalviwnikhllhtgigtasrpsevcvvdgtdmcladfhagiflkgqeh avfacvtsngwyaiddedfypwtpdpsdvlvfvpydqeplngewkakvqrklk
>d1qole_ d.3.1.2 (E:) FMDV leader protease {Foot-and-mouth disease virus [TaxId: 12110]} meltlyngekktfysrpnnhdnawlnailqlfryveepffdwvysspenltleaikqled ltglelheggppalviwnikhllhtgigtasrpsevcvvdgtdmcladfhagiflkgqeh avfacvtsngwyaiddedfypwtpdpsdvlvfvpydqkakvqrklk
Timeline for d1qole_: