SCOPe 2.07: Domain d6nufb1: 6nuf B:16-170

Lineage for d6nufb1 (6nuf B:16-170)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
   Duplication: made with two pairs of EF-hands

6. Protein Calcineurin regulatory subunit (B-chain) [47530] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47532] (11 PDB entries)

8. Domain d6nufb1: 6nuf B:16-170 [370887]
   Other proteins in same PDB: d6nufa_, d6nufb2
   automated match to d1m63b_
   complexed with ca, fe, na, peg, pge, po4, zn

Details for d6nufb1

PDB Entry: 6nuf, 1.9 Å

PDB Description: structure of calcineurin in complex with nhe1 peptide

PDB Compounds: (B:) Calcineurin subunit B type 1

SCOPe Domain Sequences for d6nufb1:

Sequence; same for both SEQRES and ATOM records:

>d6nufb1 a.39.1.5 (B:16-170) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]}
dadeikrlgkrfkkldldnsgslsveefmslpelqqnplvqrvidifdtdgngevdfkef
iegvsqfsvkgdkeqklrfafriydmdkdgyisngelfqvlkmmvgnnlkdtqlqqivdk
tiinadkdgdgrisfeefcavvggldihkkmvvdv

Timeline for d6nufb1:

• d6nufb1 is new in SCOPe 2.07-stable
  
• d6nufb1 appears in the current release, SCOPe 2.08