Lineage for d6nufb1 (6nuf B:16-170)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2319424Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2319425Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2319893Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 2319898Protein Calcineurin regulatory subunit (B-chain) [47530] (3 species)
  7. 2319901Species Human (Homo sapiens) [TaxId:9606] [47532] (11 PDB entries)
  8. 3070825Domain d6nufb1: 6nuf B:16-170 [370887]
    Other proteins in same PDB: d6nufa_, d6nufb2
    automated match to d1m63b_
    complexed with ca, fe, na, peg, pge, po4, zn

Details for d6nufb1

PDB Entry: 6nuf (more details), 1.9 Å

PDB Description: structure of calcineurin in complex with nhe1 peptide
PDB Compounds: (B:) Calcineurin subunit B type 1

SCOPe Domain Sequences for d6nufb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6nufb1 a.39.1.5 (B:16-170) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]}
dadeikrlgkrfkkldldnsgslsveefmslpelqqnplvqrvidifdtdgngevdfkef
iegvsqfsvkgdkeqklrfafriydmdkdgyisngelfqvlkmmvgnnlkdtqlqqivdk
tiinadkdgdgrisfeefcavvggldihkkmvvdv

SCOPe Domain Coordinates for d6nufb1:

Click to download the PDB-style file with coordinates for d6nufb1.
(The format of our PDB-style files is described here.)

Timeline for d6nufb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6nufb2
View in 3D
Domains from other chains:
(mouse over for more information)
d6nufa_