SCOPe 2.08: Domain d6nhgc1: 6nhg C:2-260

Lineage for d6nhgc1 (6nhg C:2-260)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies)
   core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices

4. Superfamily f.21.1: Transmembrane di-heme cytochromes [81342] (2 families)
   Three of the four heme-ligands are conserved between the two families; both heme groups bind similarly but not identically

5. Family f.21.1.2: Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81642] (3 proteins)
   a part (domain) of a larger mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria

6. Protein Mitochondrial cytochrome b subunit, N-terminal domain [81641] (3 species)
   also includes extra transmembrane (linker) helix absent in plants and cyanobacteria subunits

7. Species Cow (Bos taurus) [TaxId:9913] [81638] (19 PDB entries)
   Uniprot P00157

8. Domain d6nhgc1: 6nhg C:2-260 [370767]
   Other proteins in same PDB: d6nhga1, d6nhga2, d6nhgb1, d6nhgb2, d6nhgc2, d6nhgd1, d6nhgd2, d6nhge1, d6nhge2, d6nhgg_, d6nhgh_, d6nhgj_, d6nhgk_
   automated match to d1ntmc2
   complexed with 6pe, 8pe, azo, cdl, fes, hec, hem, mc3

Details for d6nhgc1

PDB Entry: 6nhg, 2.8 Å

PDB Description: rhodobacter sphaeroides mitochondrial respiratory chain complex

PDB Compounds: (C:) cytochrome b

SCOPe Domain Sequences for d6nhgc1:

Sequence; same for both SEQRES and ATOM records:

>d6nhgc1 f.21.1.2 (C:2-260) Mitochondrial cytochrome b subunit, N-terminal domain {Cow (Bos taurus) [TaxId: 9913]}
tnirkshplmkivnnafidlpapsnisswwnfgsllgiclilqiltglflamhytsdttt
afssvthicrdvnygwiirymhangasmfficlymhvgrglyygsytfletwnigvilll
tvmatafmgyvlpwgqmsfwgatvitnllsaipyigtnlvewiwggfsvdkatltrffaf
hfilpfiimaiamvhllflhetgsnnptgissdvdkipfhpyytikdilgalllilalml
lvlfapdllgdpdnytpan

Timeline for d6nhgc1:

• d6nhgc1 first appeared in SCOPe 2.07