Lineage for d6nhge1 (6nhg E:1-69)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2577985Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2578776Superfamily f.23.12: ISP transmembrane anchor [81502] (2 families) (S)
  5. 2578777Family f.23.12.1: ISP transmembrane anchor [81501] (2 proteins)
  6. 2578778Protein Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region [81500] (4 species)
  7. 2578794Species Cow (Bos taurus) [TaxId:9913] [81497] (19 PDB entries)
    Uniprot P13272; precursor of chains I,E and V,R
  8. 3070683Domain d6nhge1: 6nhg E:1-69 [370745]
    Other proteins in same PDB: d6nhga1, d6nhga2, d6nhgb1, d6nhgb2, d6nhgc1, d6nhgc2, d6nhgd1, d6nhgd2, d6nhge2, d6nhgg_, d6nhgh_, d6nhgj_, d6nhgk_
    automated match to d1ntme2
    complexed with 6pe, 8pe, azo, cdl, fes, hec, hem, mc3

Details for d6nhge1

PDB Entry: 6nhg (more details), 2.8 Å

PDB Description: rhodobacter sphaeroides mitochondrial respiratory chain complex
PDB Compounds: (E:) Cytochrome b-c1 complex subunit Rieske, mitochondrial

SCOPe Domain Sequences for d6nhge1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6nhge1 f.23.12.1 (E:1-69) Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region {Cow (Bos taurus) [TaxId: 9913]}
shtdikvpdfsdyrrpevldstksskessearkgfsylvtatttvgvayaaknvvsqfvs
smsasadvl

SCOPe Domain Coordinates for d6nhge1:

Click to download the PDB-style file with coordinates for d6nhge1.
(The format of our PDB-style files is described here.)

Timeline for d6nhge1: