![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
![]() | Superfamily d.3.1: Cysteine proteinases [54001] (24 families) ![]() the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
![]() | Family d.3.1.1: Papain-like [54002] (26 proteins) |
![]() | Protein (Pro)cathepsin K [54028] (3 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [54029] (56 PDB entries) Uniprot P43235 116-329 ! Uniprot P43235 115-329 |
![]() | Domain d1atka_: 1atk A: [37071] complexed with e64 |
PDB Entry: 1atk (more details), 2.2 Å
SCOPe Domain Sequences for d1atka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1atka_ d.3.1.1 (A:) (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 9606]} apdsvdyrkkgyvtpvknqgqcgscwafssvgalegqlkkktgkllnlspqnlvdcvsen dgcgggymtnafqyvqknrgidsedaypyvgqeescmynptgkaakcrgyreipegneka lkravarvgpvsvaidasltsfqfyskgvyydescnsdnlnhavlavgygiqkgnkhwii knswgenwgnkgyilmarnknnacgianlasfpkm
Timeline for d1atka_: