Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (31 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries) |
Domain d6n5df1: 6n5d F:1-110 [370705] Other proteins in same PDB: d6n5da_, d6n5db_, d6n5dc_, d6n5dd2, d6n5de_, d6n5df2, d6n5dk_, d6n5dl_, d6n5dn2 automated match to d1aqkl1 |
PDB Entry: 6n5d (more details), 3 Å
SCOPe Domain Sequences for d6n5df1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6n5df1 b.1.1.0 (F:1-110) automated matches {Mouse (Mus musculus) [TaxId: 10090]} qavvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlfagliggtknrapgv parfsgsligdkaaltitgaqtedeaiyfcalwysnhwvfgggtkltvlg
Timeline for d6n5df1: