Lineage for d6n5df1 (6n5d F:1-110)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2761257Domain d6n5df1: 6n5d F:1-110 [370705]
    Other proteins in same PDB: d6n5da_, d6n5db_, d6n5dc_, d6n5dd2, d6n5de_, d6n5df2, d6n5dk_, d6n5dl_, d6n5dn2
    automated match to d1aqkl1

Details for d6n5df1

PDB Entry: 6n5d (more details), 3 Å

PDB Description: broadly protective antibodies directed to a subdominant influenza hemagglutinin epitope
PDB Compounds: (F:) Antibody Light Chain

SCOPe Domain Sequences for d6n5df1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6n5df1 b.1.1.0 (F:1-110) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qavvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlfagliggtknrapgv
parfsgsligdkaaltitgaqtedeaiyfcalwysnhwvfgggtkltvlg

SCOPe Domain Coordinates for d6n5df1:

Click to download the PDB-style file with coordinates for d6n5df1.
(The format of our PDB-style files is described here.)

Timeline for d6n5df1: