SCOPe 2.08: Domain d6n5dd2: 6n5d D:111-212

Lineage for d6n5dd2 (6n5d D:111-212)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)

8. Domain d6n5dd2: 6n5d D:111-212 [370780]
   Other proteins in same PDB: d6n5da_, d6n5db_, d6n5dc_, d6n5dd1, d6n5de_, d6n5df1, d6n5dk_, d6n5dl_, d6n5dn1
   automated match to d1aqkl2

Details for d6n5dd2

PDB Entry: 6n5d, 3 Å

PDB Description: broadly protective antibodies directed to a subdominant influenza hemagglutinin epitope

PDB Compounds: (D:) Antibody Light Chain

SCOPe Domain Sequences for d6n5dd2:

Sequence; same for both SEQRES and ATOM records:

>d6n5dd2 b.1.1.2 (D:111-212) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qpkgapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvapt

Timeline for d6n5dd2:

• d6n5dd2 first appeared in SCOPe 2.07