SCOPe 2.02: Domain d1icf.2: 1icf C:,D:

Lineage for d1icf.2 (1icf C:,D:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (23 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.1: Papain-like [54002] (26 proteins)

6. Protein (Pro)cathepsin L [54026] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54027] (4 PDB entries)

8. Domain d1icf.2: 1icf C:,D: [37068]
   Other proteins in same PDB: d1icfi_, d1icfj_
   complexed with nag

Details for d1icf.2

PDB Entry: 1icf, 2 Å

PDB Description: crystal structure of mhc class ii associated p41 ii fragment in complex with cathepsin l

PDB Compounds: (C:) protein (cathepsin l: heavy chain), (D:) protein (cathepsin l: light chain)

SCOPe Domain Sequences for d1icf.2:

Sequence; same for both SEQRES and ATOM records:

>g1icf.2 d.3.1.1 (C:,D:) (Pro)cathepsin L {Human (Homo sapiens) [TaxId: 9606]}
aprsvdwrekgyvtpvknqgqcgscwafsatgalegqmfrktgrlislseqnlvdcsgpq
gnegcngglmdyafqyvqdnggldseesypyeateesckynpkysvandtgfvdipkqek
almkavatvgpisvaidaghesflfykegiyfepdcssedmdhgvlvvgygfestXnnky
wlvknswgeewgmggyvkmakdrrnhcgiasaasyptv

Timeline for d1icf.2:

• d1icf.2 first appeared (with stable ids) in SCOP 1.55
  
• d1icf.2 appears in SCOPe 2.01
  
• d1icf.2 appears in SCOPe 2.03
  
• d1icf.2 appears in the current release, SCOPe 2.08