PDB entry 1icf

View 1icf on RCSB PDB site
Description: crystal structure of MHC class II associated p41 II fragment in complex with cathepsin l
Class: hydrolase
Keywords: cysteine proteinase, cathepsin, MHC class II, invariant chain, thyroglobulin type-1 domain, hydrolase
Deposited on 1999-01-07, released 2000-01-12
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.182
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (cathepsin l: heavy chain)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1icf.1
  • Chain 'B':
    Compound: protein (cathepsin l: light chain)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1icf.1
  • Chain 'C':
    Compound: protein (cathepsin l: heavy chain)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1icf.2
  • Chain 'D':
    Compound: protein (cathepsin l: light chain)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1icf.2
  • Chain 'I':
    Compound: protein (invariant chain)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1icfi_
  • Chain 'J':
    Compound: protein (invariant chain)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1icfj_
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1icfA (A:)
    aprsvdwrekgyvtpvknqgqcgscwafsatgalegqmfrktgrlislseqnlvdcsgpq
    gnegcngglmdyafqyvqdnggldseesypyeateesckynpkysvandtgfvdipkqek
    almkavatvgpisvaidaghesflfykegiyfepdcssedmdhgvlvvgygfest
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1icfB (B:)
    nnkywlvknswgeewgmggyvkmakdrrnhcgiasaasyptv
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1icfC (C:)
    aprsvdwrekgyvtpvknqgqcgscwafsatgalegqmfrktgrlislseqnlvdcsgpq
    gnegcngglmdyafqyvqdnggldseesypyeateesckynpkysvandtgfvdipkqek
    almkavatvgpisvaidaghesflfykegiyfepdcssedmdhgvlvvgygfest
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1icfD (D:)
    nnkywlvknswgeewgmggyvkmakdrrnhcgiasaasyptv
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1icfI (I:)
    ltkcqeevshipavhpgsfrpkcdengnylplqcygsigycwcvfpngtevpntrsrghh
    ncses
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1icfJ (J:)
    ltkcqeevshipavhpgsfrpkcdengnylplqcygsigycwcvfpngtevpntrsrghh
    ncses