SCOPe 2.07: Domain d6mrkv_: 6mrk V:

Lineage for d6mrkv_ (6mrk V:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (31 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.0: automated matches [191337] (1 protein)
   not a true family

6. Protein automated matches [190205] (33 species)
   not a true protein

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [195496] (3 PDB entries)

8. Domain d6mrkv_: 6mrk V: [370666]
   automated match to d1jkga_
   protein/RNA complex

Details for d6mrkv_

PDB Entry: 6mrk, 2.8 Å

PDB Description: crystal structure of dmnxf2 ntf2-like domain in complex with nxt1/p15

PDB Compounds: (V:) NTF2-related export protein

SCOPe Domain Sequences for d6mrkv_:

Sequence, based on SEQRES records:

>d6mrkv_ d.17.4.0 (V:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
dsdlkakvescartadtftrlyyasvdnrrqqigrlyldnatlswngngaigrqmiesyf
qelpssnhqlntldaqpivdqavsnqlaylimasgsvkfadqqlrkfqqtfivtaendkw
kvvsdcyrmqe

Sequence, based on observed residues (ATOM records):

>d6mrkv_ d.17.4.0 (V:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
dsdlkakvescartadtftrlyyasvdnrrqqigrlyldnatlswngngaigrqmiesyf
qelpssnhqlntldaqpivdsnqlaylimasgsvkfadqqlrkfqqtfivtadkwkvvsd
cyrmqe

Timeline for d6mrkv_:

• d6mrkv_ is new in SCOPe 2.07-stable
  
• d6mrkv_ appears in the current release, SCOPe 2.08