SCOPe 2.08: Domain d6mnmb2: 6mnm B:112-239

Lineage for d6mnmb2 (6mnm B:112-239)

Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein automated matches [190374] (15 species)
not a true protein
Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)
Domain d6mnmb2: 6mnm B:112-239 [370645]
Other proteins in same PDB: d6mnma1, d6mnmb1, d6mnmc1, d6mnmc2, d6mnmc3
automated match to d4dzbb2

Details for d6mnmb2

PDB Entry: 6mnm (more details), 3.1 Å

PDB Description: 6256 tcr bound to i-ab padi4

PDB Compounds: (B:) 6256 TCR beta chain

SCOPe Domain Sequences for d6mnmb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6mnmb2 b.1.1.2 (B:112-239) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgra

SCOPe Domain Coordinates for d6mnmb2:

Click to download the PDB-style file with coordinates for d6mnmb2.
(The format of our PDB-style files is described here.)

Timeline for d6mnmb2: