SCOPe 2.08: Domain d6mnma1: 6mnm A:2-114

Lineage for d6mnma1 (6mnm A:2-114)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d6mnma1: 6mnm A:2-114 [370639]
   Other proteins in same PDB: d6mnma2, d6mnmb2, d6mnmc1, d6mnmc2, d6mnmc3
   automated match to d2f54d1

Details for d6mnma1

PDB Entry: 6mnm, 3.1 Å

PDB Description: 6256 tcr bound to i-ab padi4

PDB Compounds: (A:) 6256 TCR alpha chain

SCOPe Domain Sequences for d6mnma1:

Sequence; same for both SEQRES and ATOM records:

>d6mnma1 b.1.1.0 (A:2-114) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qvrqspqsltvwegetailncsyensafdyfpwyqqfpgegpalliairsvsdkkedgrf
tiffnkrekklslhitdsqpgdsatyfcaasatgantgkltfghgtilrvhpn

Timeline for d6mnma1:

• d6mnma1 first appeared in SCOPe 2.07