Lineage for d6mnmc1 (6mnm C:0-81)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2938649Family d.19.1.0: automated matches [227140] (1 protein)
    not a true family
  6. 2938650Protein automated matches [226842] (5 species)
    not a true protein
  7. 2938889Species Mouse (Mus musculus) [TaxId:10090] [224924] (70 PDB entries)
  8. 2938973Domain d6mnmc1: 6mnm C:0-81 [370679]
    Other proteins in same PDB: d6mnma1, d6mnma2, d6mnmb1, d6mnmb2, d6mnmc2, d6mnmc3
    automated match to d1iaka2

Details for d6mnmc1

PDB Entry: 6mnm (more details), 3.1 Å

PDB Description: 6256 tcr bound to i-ab padi4
PDB Compounds: (C:) H-2 class II histocompatibility antigen, A-B alpha chain

SCOPe Domain Sequences for d6mnmc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6mnmc1 d.19.1.0 (C:0-81) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ieadhvgtygisvyqspgdigqytfefdgdelfyvdldkketvwmlpefgqlasfdpqgg
lqniavvkhnlgvltkrsnstp

SCOPe Domain Coordinates for d6mnmc1:

Click to download the PDB-style file with coordinates for d6mnmc1.
(The format of our PDB-style files is described here.)

Timeline for d6mnmc1: