Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.0: automated matches [227140] (1 protein) not a true family |
Protein automated matches [226842] (5 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [224924] (70 PDB entries) |
Domain d6mnmc1: 6mnm C:0-81 [370679] Other proteins in same PDB: d6mnma1, d6mnma2, d6mnmb1, d6mnmb2, d6mnmc2, d6mnmc3 automated match to d1iaka2 |
PDB Entry: 6mnm (more details), 3.1 Å
SCOPe Domain Sequences for d6mnmc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6mnmc1 d.19.1.0 (C:0-81) automated matches {Mouse (Mus musculus) [TaxId: 10090]} ieadhvgtygisvyqspgdigqytfefdgdelfyvdldkketvwmlpefgqlasfdpqgg lqniavvkhnlgvltkrsnstp
Timeline for d6mnmc1:
View in 3D Domains from other chains: (mouse over for more information) d6mnma1, d6mnma2, d6mnmb1, d6mnmb2 |