SCOPe 2.08: Domain d6mazc1: 6maz C:27-210

Lineage for d6mazc1 (6maz C:27-210)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families)

5. Family d.108.1.0: automated matches [191308] (1 protein)
   not a true family

6. Protein automated matches [190038] (49 species)
   not a true protein

7. Species Plasmodium vivax [TaxId:5855] [234134] (20 PDB entries)

8. Domain d6mazc1: 6maz C:27-210 [370594]
   Other proteins in same PDB: d6maza2, d6mazb2, d6mazc2
   automated match to d1iica1
   complexed with 646, cl, edo, so4, ync; mutant

Details for d6mazc1

PDB Entry: 6maz, 1.55 Å

PDB Description: crystal structure of n-myristoyl transferase (nmt) g386e mutant from plasmodium vivax in complex with inhibitor imp-0366

PDB Compounds: (C:) Glycylpeptide N-tetradecanoyltransferase

SCOPe Domain Sequences for d6mazc1:

Sequence; same for both SEQRES and ATOM records:

>d6mazc1 d.108.1.0 (C:27-210) automated matches {Plasmodium vivax [TaxId: 5855]}
dykfwytqpvpkindefnesvnepfisdnkvedvrkdeyklppgyswyvcdvkdekdrse
iytlltdnyvedddnifrfnysaefllwaltspnylktwhigvkydasnkligfisaipt
dicihkrtikmaevnflcvhktlrskrlapvlikeitrrinleniwqaiytagvylpkpv
sdar

Timeline for d6mazc1:

• d6mazc1 first appeared in SCOPe 2.07