SCOPe 2.08: Domain d1f29c_: 1f29 C:

Lineage for d1f29c_ (1f29 C:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (24 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.1: Papain-like [54002] (26 proteins)

6. Protein Cruzain [54020] (1 species)

7. Species Trypanosoma cruzi [TaxId:5693] [54021] (29 PDB entries)

8. Domain d1f29c_: 1f29 C: [37047]
   complexed with vs1

Details for d1f29c_

PDB Entry: 1f29, 2.15 Å

PDB Description: crystal structure analysis of cruzain bound to a vinyl sulfone derived inhibitor (i)

PDB Compounds: (C:) cruzain

SCOPe Domain Sequences for d1f29c_:

Sequence; same for both SEQRES and ATOM records:

>d1f29c_ d.3.1.1 (C:) Cruzain {Trypanosoma cruzi [TaxId: 5693]}
apaavdwrargavtavkdqgqcgscwafsaignvecqwflaghpltnlseqmlvscdktd
sgcsgglmnnafewivqenngavytedsypyasgegisppcttsghtvgatitghvelpq
deaqiaawlavngpvavavdasswmtytggvmtscvseqldhgvllvgyndsaavpywii
knswttqwgeegyiriakgsnqclvkeeassavvg

Timeline for d1f29c_:

• d1f29c_ first appeared (with stable ids) in SCOP 1.55
  
• d1f29c_ appears in SCOPe 2.07