Lineage for d1f29c_ (1f29 C:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.3: Cysteine proteinases [54000] (1 superfamily) Superfamily d.3.1: Cysteine proteinases [54001] (7 families) 
Family d.3.1.1: Papain-like [54002] (15 proteins) 
Protein Cruzain [54020] (1 species) Species Trypanosoma cruzi [TaxId:5693] [54021] (7 PDB entries) 
Domain d1f29c_: 1f29 C: [37047]
Details for d1f29c_
PDB Entry: 1f29 (more details), 2.15 Å
PDB Description: crystal structure analysis of cruzain bound to a vinyl sulfone derived inhibitor (i)
SCOP Domain Sequences for d1f29c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f29c_ d.3.1.1 (C:) Cruzain {Trypanosoma cruzi}
apaavdwrargavtavkdqgqcgscwafsaignvecqwflaghpltnlseqmlvscdktd
sgcsgglmnnafewivqenngavytedsypyasgegisppcttsghtvgatitghvelpq
deaqiaawlavngpvavavdasswmtytggvmtscvseqldhgvllvgyndsaavpywii
knswttqwgeegyiriakgsnqclvkeeassavvg
SCOP Domain Coordinates for d1f29c_:
Click to download the PDB-style file with coordinates for d1f29c_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1f29c_:
- d1f29c_ appears in SCOP 1.57
- d1f29c_ appears in the current release, SCOPe 2.08
View in 3D
