| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.11: Cytochrome c oxidase subunit E [48479] (2 families) ![]() automatically mapped to Pfam PF02284 |
| Family a.118.11.1: Cytochrome c oxidase subunit E [48480] (2 proteins) |
| Protein Cytochrome c oxidase subunit E [48481] (1 species) |
| Species Cow (Bos taurus) [TaxId:9913] [48482] (50 PDB entries) |
| Domain d6j8me_: 6j8m E: [370450] Other proteins in same PDB: d6j8ma_, d6j8mb1, d6j8mb2, d6j8mc_, d6j8md_, d6j8mf_, d6j8mg_, d6j8mh_, d6j8mi_, d6j8mj_, d6j8mk_, d6j8ml_, d6j8mm_, d6j8mn_, d6j8mo1, d6j8mo2, d6j8mp_, d6j8mq_, d6j8ms_, d6j8mt_, d6j8mu_, d6j8mv_, d6j8mw_, d6j8mx_, d6j8my_, d6j8mz_ automated match to d1v54e_ complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, per, pgv, psc, tgl, zn |
PDB Entry: 6j8m (more details), 1.9 Å
SCOPe Domain Sequences for d6j8me_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6j8me_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]}
hetdeefdarwvtyfnkpdidawelrkgmntlvgydlvpepkiidaalracrrlndfasa
vrilevvkdkagphkeiypyviqelrptlnelgistpeelgldkv
Timeline for d6j8me_:
View in 3DDomains from other chains: (mouse over for more information) d6j8ma_, d6j8mb1, d6j8mb2, d6j8mc_, d6j8md_, d6j8mf_, d6j8mg_, d6j8mh_, d6j8mi_, d6j8mj_, d6j8mk_, d6j8ml_, d6j8mm_, d6j8mn_, d6j8mo1, d6j8mo2, d6j8mp_, d6j8mq_, d6j8mr_, d6j8ms_, d6j8mt_, d6j8mu_, d6j8mv_, d6j8mw_, d6j8mx_, d6j8my_, d6j8mz_ |