SCOPe 2.08: Domain d4pada_: 4pad A:

Lineage for d4pada_ (4pad A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (24 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.1: Papain-like [54002] (26 proteins)

6. Protein Papain [54005] (1 species)

7. Species Papaya (Carica papaya) [TaxId:3649] [54006] (23 PDB entries)

8. Domain d4pada_: 4pad A: [37018]
   complexed with tck

Details for d4pada_

PDB Entry: 4pad, 2.8 Å

PDB Description: binding of chloromethyl ketone substrate analogues to crystalline papain

PDB Compounds: (A:) papain

SCOPe Domain Sequences for d4pada_:

Sequence; same for both SEQRES and ATOM records:

>d4pada_ d.3.1.1 (A:) Papain {Papaya (Carica papaya) [TaxId: 3649]}
ipeyvdwrqkgavtpvknqgscgscwafsavvtiegiikirtgnlnqyseqelldcdrrs
ygcnggypwsalqlvaqygihyrntypyegvqrycrsrekgpyaaktdgvrqvqpynqga
llysianqpvsvvlqaagkdfqlyrggifvgpcgnkvdhavaavgygpnyiliknswgtg
wgengyirikrgtgnsygvcglytssfypvkn

Timeline for d4pada_:

• d4pada_ first appeared (with stable ids) in SCOP 1.55, called d4pad__
  
• d4pada_ appears in SCOPe 2.07