SCOPe 2.08: Domain d6gr2e1: 6gr2 E:5-216

Lineage for d6gr2e1 (6gr2 E:5-216)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
   core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover

4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families)

5. Family d.14.1.5: GHMP Kinase, N-terminal domain [54232] (7 proteins)

6. Protein automated matches [232306] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [362871] (16 PDB entries)

8. Domain d6gr2e1: 6gr2 E:5-216 [370122]
   Other proteins in same PDB: d6gr2a2, d6gr2b2, d6gr2c2, d6gr2d2, d6gr2e2, d6gr2f2, d6gr2g2, d6gr2h2
   automated match to d1wuua1
   complexed with adp, gal, so4

Details for d6gr2e1

PDB Entry: 6gr2, 2.49 Å

PDB Description: structure of human galactokinase in complex with galactose and adp

PDB Compounds: (E:) Galactokinase

SCOPe Domain Sequences for d6gr2e1:

Sequence; same for both SEQRES and ATOM records:

>d6gr2e1 d.14.1.5 (E:5-216) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rqpqvaellaearrafreefgaepelavsapgrvnligehtdynqglvlpmalelmtvlv
gsprkdglvsllttsegadepqrlqfplptaqrslepgtprwanyvkgviqyypaaplpg
fsavvvssvplggglsssaslevatytflqqlcpdsgtiaaraqvcqqaehsfagmpcgi
mdqfislmgqkghallidcrsletslvplsdp

Timeline for d6gr2e1:

• d6gr2e1 first appeared in SCOPe 2.07