PDB entry 6gr2

View 6gr2 on RCSB PDB site
Description: Structure of human galactokinase in complex with galactose and ADP
Class: transferase
Keywords: Leloir pathway, GHMP kinase, galactose, ADP, Structural Genomics, Structural Genomics Consortium, SGC, transferase
Deposited on 2018-06-08, released 2019-06-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-06-19, with a file datestamp of 2019-06-14.
Experiment type: XRAY
Resolution: 2.49 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Galactokinase
    Species: Homo sapiens [TaxId:9606]
    Gene: GALK1, GALK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51570 (Start-398)
      • conflict (258-259)
    Domains in SCOPe 2.07: d6gr2a1, d6gr2a2
  • Chain 'B':
    Compound: Galactokinase
    Species: Homo sapiens [TaxId:9606]
    Gene: GALK1, GALK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51570 (Start-398)
      • conflict (258-259)
    Domains in SCOPe 2.07: d6gr2b1, d6gr2b2
  • Chain 'C':
    Compound: Galactokinase
    Species: Homo sapiens [TaxId:9606]
    Gene: GALK1, GALK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51570 (Start-398)
      • conflict (258-259)
    Domains in SCOPe 2.07: d6gr2c1, d6gr2c2
  • Chain 'D':
    Compound: Galactokinase
    Species: Homo sapiens [TaxId:9606]
    Gene: GALK1, GALK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51570 (Start-398)
      • conflict (258-259)
    Domains in SCOPe 2.07: d6gr2d1, d6gr2d2
  • Chain 'E':
    Compound: Galactokinase
    Species: Homo sapiens [TaxId:9606]
    Gene: GALK1, GALK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51570 (Start-398)
      • conflict (258-259)
    Domains in SCOPe 2.07: d6gr2e1, d6gr2e2
  • Chain 'F':
    Compound: Galactokinase
    Species: Homo sapiens [TaxId:9606]
    Gene: GALK1, GALK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51570 (Start-398)
      • conflict (258-259)
    Domains in SCOPe 2.07: d6gr2f1, d6gr2f2
  • Chain 'G':
    Compound: Galactokinase
    Species: Homo sapiens [TaxId:9606]
    Gene: GALK1, GALK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51570 (Start-398)
      • conflict (258-259)
    Domains in SCOPe 2.07: d6gr2g1, d6gr2g2
  • Chain 'H':
    Compound: Galactokinase
    Species: Homo sapiens [TaxId:9606]
    Gene: GALK1, GALK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51570 (Start-398)
      • conflict (258-259)
    Domains in SCOPe 2.07: d6gr2h1, d6gr2h2
  • Heterogens: GAL, ADP, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6gr2A (A:)
    mahhhhhhaalrqpqvaellaearrafreefgaepelavsapgrvnligehtdynqglvl
    pmalelmtvlvgsprkdglvsllttsegadepqrlqfplptaqrslepgtprwanyvkgv
    iqyypaaplpgfsavvvssvplggglsssaslevatytflqqlcpdsgtiaaraqvcqqa
    ehsfagmpcgimdqfislmgqkghallidcrsletslvplsdpklavlitnsnvrhslas
    seypvrrrqceevaralgaaslrevqleeleaardlvskegfrrarhvvgeirrtaqaaa
    alrrgdyrafgrlmveshrslrddyevscpeldqlveaalavpgvygsrmtgggfggctv
    tlleasaaphamrhiqehyggtatfylsqaadgakvlcl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gr2A (A:)
    lrqpqvaellaearrafreefgaepelavsapgrvnligehtdynqglvlpmalelmtvl
    vgsprkdglvsllttsegadepqrlqfplptaqrslepgtprwanyvkgviqyypaaplp
    gfsavvvssvplggglsssaslevatytflqqlcpdsgtiaaraqvcqqaehsfagmpcg
    imdqfislmgqkghallidcrsletslvplsdpklavlitnsnvseypvrrrqceevara
    lgaaslrevqleeleaardlvskegfrrarhvvgeirrtaqaaaalrrgdyrafgrlmve
    shrslrddyevscpeldqlveaalavpgvygsrmtgggfggctvtlleasaaphamrhiq
    ehyggtatfylsqaadgakvlcl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6gr2B (B:)
    mahhhhhhaalrqpqvaellaearrafreefgaepelavsapgrvnligehtdynqglvl
    pmalelmtvlvgsprkdglvsllttsegadepqrlqfplptaqrslepgtprwanyvkgv
    iqyypaaplpgfsavvvssvplggglsssaslevatytflqqlcpdsgtiaaraqvcqqa
    ehsfagmpcgimdqfislmgqkghallidcrsletslvplsdpklavlitnsnvrhslas
    seypvrrrqceevaralgaaslrevqleeleaardlvskegfrrarhvvgeirrtaqaaa
    alrrgdyrafgrlmveshrslrddyevscpeldqlveaalavpgvygsrmtgggfggctv
    tlleasaaphamrhiqehyggtatfylsqaadgakvlcl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gr2B (B:)
    qpqvaellaearrafreefgaepelavsapgrvnligehtdynqglvlpmalelmtvlvg
    sprkdglvsllttsegadepqrlqfplptaqrslepgtprwanyvkgviqyypaaplpgf
    savvvssvplggglsssaslevatytflqqlcpdsgtiaaraqvcqqaehsfagmpcgim
    dqfislmgqkghallidcrsletslvplsdpklavlitnsnvrseypvrrrqceevaral
    gaaslrevqleeleaardlvskegfrrarhvvgeirrtaqaaaalrrgdyrafgrlmves
    hrslrddyevscpeldqlveaalavpgvygsrmtgggfggctvtlleasaaphamrhiqe
    hyggtatfylsqaadgakvlcl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6gr2C (C:)
    mahhhhhhaalrqpqvaellaearrafreefgaepelavsapgrvnligehtdynqglvl
    pmalelmtvlvgsprkdglvsllttsegadepqrlqfplptaqrslepgtprwanyvkgv
    iqyypaaplpgfsavvvssvplggglsssaslevatytflqqlcpdsgtiaaraqvcqqa
    ehsfagmpcgimdqfislmgqkghallidcrsletslvplsdpklavlitnsnvrhslas
    seypvrrrqceevaralgaaslrevqleeleaardlvskegfrrarhvvgeirrtaqaaa
    alrrgdyrafgrlmveshrslrddyevscpeldqlveaalavpgvygsrmtgggfggctv
    tlleasaaphamrhiqehyggtatfylsqaadgakvlcl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gr2C (C:)
    lrqpqvaellaearrafreefgaepelavsapgrvnligehtdynqglvlpmalelmtvl
    vgsprkdglvsllttsegadepqrlqfplptaqrslepgtprwanyvkgviqyypaaplp
    gfsavvvssvplggglsssaslevatytflqqlcpdsgtiaaraqvcqqaehsfagmpcg
    imdqfislmgqkghallidcrsletslvplsdpklavlitnsnvrhsseypvrrrqceev
    aralgaaslrevqleeleaardlvskegfrrarhvvgeirrtaqaaaalrrgdyrafgrl
    mveshrslrddyevscpeldqlveaalavpgvygsrmtgggfggctvtlleasaaphamr
    hiqehyggtatfylsqaadgakvlcl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6gr2D (D:)
    mahhhhhhaalrqpqvaellaearrafreefgaepelavsapgrvnligehtdynqglvl
    pmalelmtvlvgsprkdglvsllttsegadepqrlqfplptaqrslepgtprwanyvkgv
    iqyypaaplpgfsavvvssvplggglsssaslevatytflqqlcpdsgtiaaraqvcqqa
    ehsfagmpcgimdqfislmgqkghallidcrsletslvplsdpklavlitnsnvrhslas
    seypvrrrqceevaralgaaslrevqleeleaardlvskegfrrarhvvgeirrtaqaaa
    alrrgdyrafgrlmveshrslrddyevscpeldqlveaalavpgvygsrmtgggfggctv
    tlleasaaphamrhiqehyggtatfylsqaadgakvlcl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gr2D (D:)
    lrqpqvaellaearrafreefgaepelavsapgrvnligehtdynqglvlpmalelmtvl
    vgsprkdglvsllttsegadepqrlqfplptaqrslepgtprwanyvkgviqyypaaplp
    gfsavvvssvplggglsssaslevatytflqqlcpdsgtiaaraqvcqqaehsfagmpcg
    imdqfislmgqkghallidcrsletslvplsdpklavlitnsnvasseypvrrrqceeva
    ralgaaslrevqleeleaardlvskegfrrarhvvgeirrtaqaaaalrrgdyrafgrlm
    veshrslrddyevscpeldqlveaalavpgvygsrmtgggfggctvtlleasaaphamrh
    iqehyggtatfylsqaadgakvlcl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6gr2E (E:)
    mahhhhhhaalrqpqvaellaearrafreefgaepelavsapgrvnligehtdynqglvl
    pmalelmtvlvgsprkdglvsllttsegadepqrlqfplptaqrslepgtprwanyvkgv
    iqyypaaplpgfsavvvssvplggglsssaslevatytflqqlcpdsgtiaaraqvcqqa
    ehsfagmpcgimdqfislmgqkghallidcrsletslvplsdpklavlitnsnvrhslas
    seypvrrrqceevaralgaaslrevqleeleaardlvskegfrrarhvvgeirrtaqaaa
    alrrgdyrafgrlmveshrslrddyevscpeldqlveaalavpgvygsrmtgggfggctv
    tlleasaaphamrhiqehyggtatfylsqaadgakvlcl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gr2E (E:)
    rqpqvaellaearrafreefgaepelavsapgrvnligehtdynqglvlpmalelmtvlv
    gsprkdglvsllttsegadepqrlqfplptaqrslepgtprwanyvkgviqyypaaplpg
    fsavvvssvplggglsssaslevatytflqqlcpdsgtiaaraqvcqqaehsfagmpcgi
    mdqfislmgqkghallidcrsletslvplsdpklavlitnsnvasseypvrrrqceevar
    algaaslrevqleeleaardlvskegfrrarhvvgeirrtaqaaaalrrgdyrafgrlmv
    eshrslrddyevscpeldqlveaalavpgvygsrmtgggfggctvtlleasaaphamrhi
    qehyggtatfylsqaadgakvlcl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6gr2F (F:)
    mahhhhhhaalrqpqvaellaearrafreefgaepelavsapgrvnligehtdynqglvl
    pmalelmtvlvgsprkdglvsllttsegadepqrlqfplptaqrslepgtprwanyvkgv
    iqyypaaplpgfsavvvssvplggglsssaslevatytflqqlcpdsgtiaaraqvcqqa
    ehsfagmpcgimdqfislmgqkghallidcrsletslvplsdpklavlitnsnvrhslas
    seypvrrrqceevaralgaaslrevqleeleaardlvskegfrrarhvvgeirrtaqaaa
    alrrgdyrafgrlmveshrslrddyevscpeldqlveaalavpgvygsrmtgggfggctv
    tlleasaaphamrhiqehyggtatfylsqaadgakvlcl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gr2F (F:)
    qpqvaellaearrafreefgaepelavsapgrvnligehtdynqglvlpmalelmtvlvg
    sprkdglvsllttsegadepqrlqfplptaqrslepgtprwanyvkgviqyypaaplpgf
    savvvssvplggglsssaslevatytflqqlcpdsgtiaaraqvcqqaehsfagmpcgim
    dqfislmgqkghallidcrsletslvplsdpklavlitnsnvrhsseypvrrrqceevar
    algaaslrevqleeleaardlvskegfrrarhvvgeirrtaqaaaalrrgdyrafgrlmv
    eshrslrddyevscpeldqlveaalavpgvygsrmtgggfggctvtlleasaaphamrhi
    qehyggtatfylsqaadgakvlcl
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >6gr2G (G:)
    mahhhhhhaalrqpqvaellaearrafreefgaepelavsapgrvnligehtdynqglvl
    pmalelmtvlvgsprkdglvsllttsegadepqrlqfplptaqrslepgtprwanyvkgv
    iqyypaaplpgfsavvvssvplggglsssaslevatytflqqlcpdsgtiaaraqvcqqa
    ehsfagmpcgimdqfislmgqkghallidcrsletslvplsdpklavlitnsnvrhslas
    seypvrrrqceevaralgaaslrevqleeleaardlvskegfrrarhvvgeirrtaqaaa
    alrrgdyrafgrlmveshrslrddyevscpeldqlveaalavpgvygsrmtgggfggctv
    tlleasaaphamrhiqehyggtatfylsqaadgakvlcl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gr2G (G:)
    rqpqvaellaearrafreefgaepelavsapgrvnligehtdynqglvlpmalelmtvlv
    gsprkdglvsllttsegadepqrlqfplptaqrslepgtprwanyvkgviqyypaaplpg
    fsavvvssvplggglsssaslevatytflqqlcpdsgtiaaraqvcqqaehsfagmpcgi
    mdqfislmgqkghallidcrsletslvplsdpklavlitnsnseypvrrrqceevaralg
    aaslrevqleeleaardlvskegfrrarhvvgeirrtaqaaaalrrgdyrafgrlmvesh
    rslrddyevscpeldqlveaalavpgvygsrmtgggfggctvtlleasaaphamrhiqeh
    yggtatfylsqaadgakvlcl
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >6gr2H (H:)
    mahhhhhhaalrqpqvaellaearrafreefgaepelavsapgrvnligehtdynqglvl
    pmalelmtvlvgsprkdglvsllttsegadepqrlqfplptaqrslepgtprwanyvkgv
    iqyypaaplpgfsavvvssvplggglsssaslevatytflqqlcpdsgtiaaraqvcqqa
    ehsfagmpcgimdqfislmgqkghallidcrsletslvplsdpklavlitnsnvrhslas
    seypvrrrqceevaralgaaslrevqleeleaardlvskegfrrarhvvgeirrtaqaaa
    alrrgdyrafgrlmveshrslrddyevscpeldqlveaalavpgvygsrmtgggfggctv
    tlleasaaphamrhiqehyggtatfylsqaadgakvlcl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gr2H (H:)
    qpqvaellaearrafreefgaepelavsapgrvnligehtdynqglvlpmalelmtvlvg
    sprkdglvsllttsegadepqrlqfplptaqrslepgtprwanyvkgviqyypaaplpgf
    savvvssvplggglsssaslevatytflqqlcpdsgtiaaraqvcqqaehsfagmpcgim
    dqfislmgqkghallidcrsletslvplsdpklavlitnsnvseypvrrrqceevaralg
    aaslrevqleeleaardlvskegfrrarhvvgeirrtaqaaaalrrgdyrafgrlmvesh
    rslrddyevscpeldqlveaalavpgvygsrmtgggfggctvtlleasaaphamrhiqeh
    yggtatfylsqaadgakvlcl