SCOPe 2.08: Domain d6haxg1: 6hax G:17-112

Lineage for d6haxg1 (6hax G:17-112)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.42: POZ domain [54694] (1 superfamily)
   core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143

4. Superfamily d.42.1: POZ domain [54695] (3 families)

5. Family d.42.1.1: BTB/POZ domain [54696] (6 proteins)

6. Protein Elongin C [54699] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54700] (56 PDB entries)

8. Domain d6haxg1: 6hax G:17-112 [370025]
   Other proteins in same PDB: d6haxa_, d6haxb_, d6haxc2, d6haxd_, d6haxe1, d6haxe2, d6haxf_, d6haxg2, d6haxh_
   automated match to d1lm8c_
   complexed with edo, epe, fwz

Details for d6haxg1

PDB Entry: 6hax, 2.35 Å

PDB Description: crystal structure of protac 2 in complex with the bromodomain of human smarca2 and pvhl:elonginc:elonginb

PDB Compounds: (G:) Elongin-C

SCOPe Domain Sequences for d6haxg1:

Sequence; same for both SEQRES and ATOM records:

>d6haxg1 d.42.1.1 (G:17-112) Elongin C {Human (Homo sapiens) [TaxId: 9606]}
myvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcmy
ftykvrytnssteipefpiapeialellmaanfldc

Timeline for d6haxg1:

• d6haxg1 first appeared in SCOPe 2.07