Lineage for d6haxb_ (6hax B:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2364769Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2364948Superfamily b.3.3: VHL [49468] (1 family) (S)
    automatically mapped to Pfam PF01847
  5. 2364949Family b.3.3.1: VHL [49469] (2 proteins)
  6. 2364950Protein VHL [49470] (1 species)
  7. 2364951Species Human (Homo sapiens) [TaxId:9606] [49471] (38 PDB entries)
  8. 3070094Domain d6haxb_: 6hax B: [370156]
    Other proteins in same PDB: d6haxa_, d6haxc1, d6haxc2, d6haxd_, d6haxe1, d6haxe2, d6haxg1, d6haxg2, d6haxh_
    automated match to d1lqbc_
    complexed with edo, epe, fwz

Details for d6haxb_

PDB Entry: 6hax (more details), 2.35 Å

PDB Description: crystal structure of protac 2 in complex with the bromodomain of human smarca2 and pvhl:elonginc:elonginb
PDB Compounds: (B:) von hippel-lindau disease tumor suppressor

SCOPe Domain Sequences for d6haxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6haxb_ b.3.3.1 (B:) VHL {Human (Homo sapiens) [TaxId: 9606]}
rpvlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlf
rdagthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpenyrrld
ivrslyedledhpnvqkdlerltqeriah

SCOPe Domain Coordinates for d6haxb_:

Click to download the PDB-style file with coordinates for d6haxb_.
(The format of our PDB-style files is described here.)

Timeline for d6haxb_:

  • d6haxb_ is new in SCOPe 2.07-stable