Lineage for d6eg8c_ (6eg8 C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2733644Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 2733784Superfamily a.137.3: Transducin (heterotrimeric G protein), gamma chain [48670] (1 family) (S)
    long alpha-helix interrupted in the middle
    automatically mapped to Pfam PF00631
  5. 2733785Family a.137.3.1: Transducin (heterotrimeric G protein), gamma chain [48671] (2 proteins)
  6. 2733786Protein Transducin (heterotrimeric G protein), gamma chain [48672] (1 species)
  7. 2733787Species Cow (Bos taurus) [TaxId:9913] [48673] (72 PDB entries)
  8. 2733832Domain d6eg8c_: 6eg8 C: [369938]
    Other proteins in same PDB: d6eg8a_, d6eg8b1, d6eg8b2, d6eg8d1, d6eg8d2, d6eg8f1, d6eg8f2
    automated match to d1gg2g_
    complexed with gdp, mg

Details for d6eg8c_

PDB Entry: 6eg8 (more details), 2.8 Å

PDB Description: structure of the gdp-bound gs heterotrimer
PDB Compounds: (C:) Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2

SCOPe Domain Sequences for d6eg8c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6eg8c_ a.137.3.1 (C:) Transducin (heterotrimeric G protein), gamma chain {Cow (Bos taurus) [TaxId: 9913]}
siaqarklveqlkmeanidrikvskaaadlmayceahakedplltpvpasenpfrek

SCOPe Domain Coordinates for d6eg8c_:

Click to download the PDB-style file with coordinates for d6eg8c_.
(The format of our PDB-style files is described here.)

Timeline for d6eg8c_: