![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.128: Terpenoid synthases [48575] (1 superfamily) multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers |
![]() | Superfamily a.128.1: Terpenoid synthases [48576] (6 families) ![]() duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J |
![]() | Family a.128.1.0: automated matches [196408] (1 protein) not a true family |
![]() | Protein automated matches [196409] (46 species) not a true protein |
![]() | Species Santalum album [TaxId:35974] [367260] (11 PDB entries) |
![]() | Domain d6a3xa2: 6a3x A:237-563 [369478] Other proteins in same PDB: d6a3xa1 automated match to d2onha2 complexed with sne, so4 |
PDB Entry: 6a3x (more details), 1.75 Å
SCOPe Domain Sequences for d6a3xa2:
Sequence, based on SEQRES records: (download)
>d6a3xa2 a.128.1.0 (A:237-563) automated matches {Santalum album [TaxId: 35974]} mnptllkyakldfnivqsfhqaeigrlarwwvgtgldklpfarngliqsymyaigmlfep hlgevremeakvgalittiddvydvygtmeelelftditerwdinrvdqlprnirmpllt mfntsndigywalkergfngipytakvwadqlksytkeakwfheghkptleeylenalvs igfpnllvtsylltvdnptkekldyvdslplfvrascilcriindlgtspdemergdnlk siqcymnetgasqevarehieglvrmwwkrlnkclfepspftepflsftinvvrgshffy qygdgygnaeswtknqgmsvlihpitl
>d6a3xa2 a.128.1.0 (A:237-563) automated matches {Santalum album [TaxId: 35974]} mnptllkyakldfnivqsfhqaeigrlarwwvgtgldklpfarngliqsymyaigmlfep hlgevremeakvgalittiddvydvygtmeelelftditerwdinrvdqlprnirmpllt mfntsndigywalkergfngipytakvwadqlksytkeakwfheghkptleeylenalvs igfpnllvtsylltvdnptkekldyvdslplfvrascilcriindlgtdnlksiqcymne tgasqevarehieglvrmwwkrlnkclfepspftepflsftinvvrgshffyqaeswtkn qgmsvlihpitl
Timeline for d6a3xa2: