SCOPe 2.08: Domain d6a3xa1: 6a3x A:34-236

Lineage for d6a3xa1 (6a3x A:34-236)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
   multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies

4. Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families)

5. Family a.102.4.0: automated matches [227201] (1 protein)
   not a true family

6. Protein automated matches [226931] (12 species)
   not a true protein

7. Species Santalum album [TaxId:35974] [367258] (11 PDB entries)

8. Domain d6a3xa1: 6a3x A:34-236 [369477]
   Other proteins in same PDB: d6a3xa2
   automated match to d2onha1
   complexed with sne, so4

Details for d6a3xa1

PDB Entry: 6a3x, 1.75 Å

PDB Description: crystal structure of a synthase 1 from santalum album in complex with ligand s

PDB Compounds: (A:) Sesquisabinene B synthase 1

SCOPe Domain Sequences for d6a3xa1:

Sequence; same for both SEQRES and ATOM records:

>d6a3xa1 a.102.4.0 (A:34-236) automated matches {Santalum album [TaxId: 35974]}
anlwdydflqslgrhssvteehvglaeklkgevkslitgpmeplaklefidsvrrlglky
qfetemkealaniskdgydswwvdnlratalrfrllrengifvpqdvferfqnketgkfk
nelcedvkgllnlyeasflgwegedildeartfstaqlknvegkisspnlakivhhaldl
plhwrairyearwfidiyedeed

Timeline for d6a3xa1:

• d6a3xa1 first appeared in SCOPe 2.07