Lineage for d5zs8c_ (5zs8 C:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)
core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the restSuperfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families) 
Family c.60.1.1: Cofactor-dependent phosphoglycerate mutase [53255] (4 proteins) 
Protein automated matches [190196] (7 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [186938] (20 PDB entries) 
Domain d5zs8c_: 5zs8 C: [369240]
automated match to d1yjxa_
complexed with 9jf, aly, cl, mes
Details for d5zs8c_
PDB Entry: 5zs8 (more details), 2.2 Å
PDB Description: acetylation of lysine 100 of phosphoglycerate mutase 1 complexed with kh_ol
PDB Compounds: (C:) phosphoglycerate mutase 1SCOPe Domain Sequences for d5zs8c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5zs8c_ c.60.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aayklvlirhgesawnlenrfsgwydadlspagheeakrggqalrdagyefdicftsvqk
rairtlwtvldaidqmwlpvvrtwrlnerhyggltglnkaetaakhgeaqvkiwrrsydv
ppppmepdhpfysniskdrryadltedqlpsceslkdtiaralpfwneeivpqikegkrv
liaahgnslrgivkhleglseeaimelnlptgipivyeldknlkpikpmqflgdeetvrk
SCOPe Domain Coordinates for d5zs8c_:
Click to download the PDB-style file with coordinates for d5zs8c_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5zs8c_:
- d5zs8c_ first appeared in SCOPe 2.07
View in 3D
