PDB entry 5zs8

View 5zs8 on RCSB PDB site
Description: Acetylation of lysine 100 of Phosphoglycerate mutase 1 complexed with KH_ol
Class: isomerase
Keywords: Phosphoglycerate mutase 1, ISOMERASE
Deposited on 2018-04-28, released 2019-05-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-05-22, with a file datestamp of 2019-05-17.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: phosphoglycerate mutase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PGAM1, PGAMA, CDABP0006
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zs8b_
  • Chain 'C':
    Compound: phosphoglycerate mutase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PGAM1, PGAMA, CDABP0006
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zs8c_
  • Heterogens: 9JF, ALY, CL, MES, HOH

PDB Chain Sequences:

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5zs8B (B:)
    aayklvlirhgesawnlenrfsgwydadlspagheeakrggqalrdagyefdicftsvqk
    rairtlwtvldaidqmwlpvvrtwrlnerhyggltglnkaetaakhgeaqvkiwrrsydv
    ppppmepdhpfysniskdrryadltedqlpsceslkdtiaralpfwneeivpqikegkrv
    liaahgnslrgivkhleglseeaimelnlptgipivyeldknlkpikpmqflgd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zs8B (B:)
    ayklvlirhgesawnlenrfsgwydadlspagheeakrggqalrdagyefdicftsvqkr
    airtlwtvldaidqmwlpvvrtwrlnerhyggltglnkaetaakhgeaqvkiwrrsydvp
    pppmepdhpfysniskdrryadltedqlpsceslkdtiaralpfwneeivpqikegkrvl
    iaahgnslrgivkhleglseeaimelnlptgipivyeldknlkpikpmqflgd
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5zs8C (C:)
    aayklvlirhgesawnlenrfsgwydadlspagheeakrggqalrdagyefdicftsvqk
    rairtlwtvldaidqmwlpvvrtwrlnerhyggltglnkaetaakhgeaqvkiwrrsydv
    ppppmepdhpfysniskdrryadltedqlpsceslkdtiaralpfwneeivpqikegkrv
    liaahgnslrgivkhleglseeaimelnlptgipivyeldknlkpikpmqflgdeetvrk